(data stored in ACNUC30630 zone)

EMBL: AE000513.PE402

AE000513.PE402       Location/Qualifiers
FT   CDS             417705..417947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0416"
FT                   /product="ppGpp-regulated growth inhibitor suppressor
FT                   ChpR/MazE, putative"
FT                   /note="similar to GB:D16450 SP:P18534 PID:416196 PID:506193
FT                   PID:882677 percent identity: 63.29; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09994"
FT                   /db_xref="GOA:Q9RX99"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX99"
FT                   /protein_id="AAF09994.1"
FT                   /translation="MTSQIQKWGNSLALRIPKALAQQVGLTQSSEVELLLQDGQIVIRP
FT                   VPARQYDLAALLAEMTPENLHGETDWGALEGREEW"
     MTSQIQKWGN SLALRIPKAL AQQVGLTQSS EVELLLQDGQ IVIRPVPARQ YDLAALLAEM        60
     TPENLHGETD WGALEGREEW                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page