(data stored in ACNUC30630 zone)

EMBL: AE000513.PE410

AE000513.PE410       Location/Qualifiers
FT   CDS             423757..424491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0424"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="similar to SP:P48054 PID:1001734 PID:1001734 percent
FT                   identity: 63.50; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10002"
FT                   /db_xref="GOA:Q9RX91"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX91"
FT                   /protein_id="AAF10002.1"
FT                   /translation="MIKGKWRGVRGGPCLLCRPAFGRVGPGSGALTRARPSRAALHRRL
FT                   YLRPMPRTAAVTRTTKETDITVRLDLDAAPYEQPATGHGFFDHMLDALARHSRLGISIS
FT                   GTGDLHIEPHHLIEDTGITLGQALSQALGDRKGIERYGSAFVPMDETLAHVVLDLSGRA
FT                   HLAFEPETLDVYGDAGGMTHYHLREFLRGFCNHAGATLHVRLLAGREAHHVIEAVMKAF
FT                   ARALRDAVAVTSDALPSTKGSL"
     MIKGKWRGVR GGPCLLCRPA FGRVGPGSGA LTRARPSRAA LHRRLYLRPM PRTAAVTRTT        60
     KETDITVRLD LDAAPYEQPA TGHGFFDHML DALARHSRLG ISISGTGDLH IEPHHLIEDT       120
     GITLGQALSQ ALGDRKGIER YGSAFVPMDE TLAHVVLDLS GRAHLAFEPE TLDVYGDAGG       180
     MTHYHLREFL RGFCNHAGAT LHVRLLAGRE AHHVIEAVMK AFARALRDAV AVTSDALPST       240
     KGSL                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page