(data stored in ACNUC30630 zone)

EMBL: AE000513.PE418

AE000513.PE418       Location/Qualifiers
FT   CDS             430655..431299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0432"
FT                   /product="DNA-binding response regulator"
FT                   /note="similar to GP:1498492 percent identity: 64.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10009"
FT                   /db_xref="GOA:Q9RX83"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX83"
FT                   /protein_id="AAF10009.1"
FT                   /translation="MIRVLLADDHALFRQGLRSLLESEGMRVIGEAANGREAVRYAADT
FT                   QPDVILMDIQMPELDGVKATQSILEINPQARVIMITMYRQDRYVFEAVKAGARGYILKD
FT                   ADAGTLIDAITRVAAGEALLDADMAQNVLDDFRDKREELPSEKHADLNERETMILKLLA
FT                   QGFSNQDIALRLDISEKTVRNRLSEIFTKLQLNNRTQAALYAIREGIANLE"
     MIRVLLADDH ALFRQGLRSL LESEGMRVIG EAANGREAVR YAADTQPDVI LMDIQMPELD        60
     GVKATQSILE INPQARVIMI TMYRQDRYVF EAVKAGARGY ILKDADAGTL IDAITRVAAG       120
     EALLDADMAQ NVLDDFRDKR EELPSEKHAD LNERETMILK LLAQGFSNQD IALRLDISEK       180
     TVRNRLSEIF TKLQLNNRTQ AALYAIREGI ANLE                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page