(data stored in ACNUC30630 zone)

EMBL: AE000513.PE42

AE000513.PE42        Location/Qualifiers
FT   CDS             complement(41990..42775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0043"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09637"
FT                   /db_xref="GOA:Q9RYA7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA7"
FT                   /protein_id="AAF09637.1"
FT                   /translation="MTVPGYVIRDVTDPQAMRELEDVQAAAWGFEDREVLPATMFRISA
FT                   ATGGIVLAAYRAEGGPAVGLAYGFPALGGLLGRELPGRGHDLWHHSHFLALRPEVRGSG
FT                   LAVALKLAQRGRALAQGLTRMTWTFDPLVARNARLNFGKLGVTASTYLPDWYAPHADRL
FT                   LVEWDLTRPHVPAPASPPLGTVVLRGVGARPGTPDLSADAPTVLAEVPLAVSDEERAPW
FT                   RLALRDTLTAYLGRGYRVTDLARESERAFYVLKRHPEGQ"
     MTVPGYVIRD VTDPQAMREL EDVQAAAWGF EDREVLPATM FRISAATGGI VLAAYRAEGG        60
     PAVGLAYGFP ALGGLLGREL PGRGHDLWHH SHFLALRPEV RGSGLAVALK LAQRGRALAQ       120
     GLTRMTWTFD PLVARNARLN FGKLGVTAST YLPDWYAPHA DRLLVEWDLT RPHVPAPASP       180
     PLGTVVLRGV GARPGTPDLS ADAPTVLAEV PLAVSDEERA PWRLALRDTL TAYLGRGYRV       240
     TDLARESERA FYVLKRHPEG Q                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page