(data stored in ACNUC30630 zone)

EMBL: AE000513.PE424

AE000513.PE424       Location/Qualifiers
FT   CDS             435905..436201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0438"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX77"
FT                   /protein_id="AAF10024.1"
FT                   /translation="MHVLAAAAGGVPDLGAELPGEPDHKLNGVLVALLDQVSQVLGQTV
FT                   GQGHGAELVAVFAAELLEPLGVRVRRGLARDGRLRHGLNLTQAHSRNVSQKAV"
     MHVLAAAAGG VPDLGAELPG EPDHKLNGVL VALLDQVSQV LGQTVGQGHG AELVAVFAAE        60
     LLEPLGVRVR RGLARDGRLR HGLNLTQAHS RNVSQKAV                                98
//

If you have problems or comments...

PBIL Back to PBIL home page