(data stored in ACNUC30630 zone)

EMBL: AE000513.PE431

AE000513.PE431       Location/Qualifiers
FT   CDS             442103..442678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10034"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX70"
FT                   /protein_id="AAF10034.1"
FT                   /translation="MVEKALARFATELDLDGVDVVLMSSTFTLPETGVHGYAPNAHQVD
FT                   LSVTPGSPAFQRLWLTEVPATLAHELHHVRRWRGPGYGKTLLEALVSEGLAQHFEAGYR
FT                   GESPIYAQPTMDLAALWERAQPQLSAPHDHAAWFFGSPAQDFPRWGGYALGYELVRRFF
FT                   AAQGGDAVSHANTPASAFEGAWWVSCLT"
     MVEKALARFA TELDLDGVDV VLMSSTFTLP ETGVHGYAPN AHQVDLSVTP GSPAFQRLWL        60
     TEVPATLAHE LHHVRRWRGP GYGKTLLEAL VSEGLAQHFE AGYRGESPIY AQPTMDLAAL       120
     WERAQPQLSA PHDHAAWFFG SPAQDFPRWG GYALGYELVR RFFAAQGGDA VSHANTPASA       180
     FEGAWWVSCL T                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page