(data stored in ACNUC30630 zone)

EMBL: AE000513.PE432

AE000513.PE432       Location/Qualifiers
FT   CDS             complement(442679..442990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 56.41;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10025"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX69"
FT                   /protein_id="AAF10025.1"
FT                   /translation="MITVMNRIGVKPEFAAQFEESFRNRAGLVDGMPGFIRNEVLKPTK
FT                   PGDPYIVLTYWQDEPSFRAWTESDEFKQGHARSGSLPHDAFTGRPVLEVHDVLLSSDN"
     MITVMNRIGV KPEFAAQFEE SFRNRAGLVD GMPGFIRNEV LKPTKPGDPY IVLTYWQDEP        60
     SFRAWTESDE FKQGHARSGS LPHDAFTGRP VLEVHDVLLS SDN                         103
//

If you have problems or comments...

PBIL Back to PBIL home page