(data stored in ACNUC30630 zone)

EMBL: AE000513.PE444

AE000513.PE444       Location/Qualifiers
FT   CDS             451333..453852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10038"
FT                   /db_xref="GOA:Q9RX57"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX57"
FT                   /protein_id="AAF10038.1"
FT                   /translation="MTSYSRPSRFDLQRPEVRERLWSAAATFTLHAALIAGLALARPQP
FT                   QASVAAVPDTRHAPLEVVALAPEVPNSNAAAPLSTSPLAASPNKPAPATKPTPTPAKPA
FT                   TPAPEPPKPPEPTPPEPKPETPPEPPKPAPEPPKPDPTPAEPLKPPVQDTPPPVTPKPV
FT                   TPEPVTPKPAPTPPEVLQPPVAQTPPVAKPPVPAPTSQTPTPPVQPAPTRTPPPQAARP
FT                   TPNAPAQTPAPATQAPAAQTPTAQAPATQTPATPAPAAQRPAGGAPSPAPAPAQANAPA
FT                   GSVVPEATVPESSTPAAPSAQTPPTPTRETAQTEASPAAPNSSAAAPNEPASEPVAGRP
FT                   GTAASSPESASPVTVTPRGETPDTAASAGTPSAGRVTPAPAPSASEGASAARTPGAGSQ
FT                   TPPIPATPIPATPAGRSSGESAGTAAARPNAAPAPVSEDRSDVSGLPRREDAPAESSPV
FT                   AASPARGASSAPSSAPAAAVPSRAPVSGGSVSAPRTAPTAPVAEQGEVPVSPSAAAPRG
FT                   GASSAAAPSAPAAARGGSGAAGGAAGGASAPAAARPAQTPGASAGGASGGGEGVSARPS
FT                   QGGTPSGTPASAPVAAGRPAGGEGSGSGTSGSGSGAPAAARPGQGGSGDAPVDLGLTSG
FT                   RGGSGAGNGGAGTGETGAGTPSASRPGSGGTGNGSGTGEGSGTVPASGRGTGGSGTGTG
FT                   NGGGAGEGAGVGAVARGGGGAGQGAGNETRPLTCTVVVDVRGLGKLESAMTSFVMDSAG
FT                   NQVWPDAELIKGVATQLVQEGNLQEYTRSEAGLAQLKNVTRVKASRLLRPKQSPGAPYF
FT                   ADVELSADAAQTFRSAGKACKVVYLRD"
     MTSYSRPSRF DLQRPEVRER LWSAAATFTL HAALIAGLAL ARPQPQASVA AVPDTRHAPL        60
     EVVALAPEVP NSNAAAPLST SPLAASPNKP APATKPTPTP AKPATPAPEP PKPPEPTPPE       120
     PKPETPPEPP KPAPEPPKPD PTPAEPLKPP VQDTPPPVTP KPVTPEPVTP KPAPTPPEVL       180
     QPPVAQTPPV AKPPVPAPTS QTPTPPVQPA PTRTPPPQAA RPTPNAPAQT PAPATQAPAA       240
     QTPTAQAPAT QTPATPAPAA QRPAGGAPSP APAPAQANAP AGSVVPEATV PESSTPAAPS       300
     AQTPPTPTRE TAQTEASPAA PNSSAAAPNE PASEPVAGRP GTAASSPESA SPVTVTPRGE       360
     TPDTAASAGT PSAGRVTPAP APSASEGASA ARTPGAGSQT PPIPATPIPA TPAGRSSGES       420
     AGTAAARPNA APAPVSEDRS DVSGLPRRED APAESSPVAA SPARGASSAP SSAPAAAVPS       480
     RAPVSGGSVS APRTAPTAPV AEQGEVPVSP SAAAPRGGAS SAAAPSAPAA ARGGSGAAGG       540
     AAGGASAPAA ARPAQTPGAS AGGASGGGEG VSARPSQGGT PSGTPASAPV AAGRPAGGEG       600
     SGSGTSGSGS GAPAAARPGQ GGSGDAPVDL GLTSGRGGSG AGNGGAGTGE TGAGTPSASR       660
     PGSGGTGNGS GTGEGSGTVP ASGRGTGGSG TGTGNGGGAG EGAGVGAVAR GGGGAGQGAG       720
     NETRPLTCTV VVDVRGLGKL ESAMTSFVMD SAGNQVWPDA ELIKGVATQL VQEGNLQEYT       780
     RSEAGLAQLK NVTRVKASRL LRPKQSPGAP YFADVELSAD AAQTFRSAGK ACKVVYLRD        839
//

If you have problems or comments...

PBIL Back to PBIL home page