(data stored in ACNUC30630 zone)

EMBL: AE000513.PE446

AE000513.PE446       Location/Qualifiers
FT   CDS             complement(454915..456843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0460"
FT                   /product="acetyl-CoA synthase"
FT                   /note="similar to PID:1001216 PID:1001254 percent identity:
FT                   62.90; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10039"
FT                   /db_xref="GOA:Q9RX55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX55"
FT                   /protein_id="AAF10039.1"
FT                   /translation="MDPALLTTPLVSPTDALKKTAPVTPERAQQLRDMPAGDYWLSVAS
FT                   ELTWDVPPTTALEGTFGDFQYFPGAKGNVSVNCLDRHPKNRVALYYEREDGLKETWSYG
FT                   DLTDATARFAAALQDLGVDKGDRVAIYLSNVPEAFIAIHACYRIGAIYSVIFAGFSASA
FT                   VRDRLTDAQPKVVVCTDGTLRRGRNIPLKATLDEALEGLEKPTVIVARRLDPFLPLGEN
FT                   ELDFAELLEKTTRRAAPVSLDANDPGFIIYTSGTTSKPKGLVHSGIGFLTGTYANVKWA
FT                   LNLQPDDVYWCTADVGWLTFPIFALVGGLAHGATHVIYEGSIDTPTPERPYQIIERYRA
FT                   DKVFTAPTALRMLRRSGDEALARYDLSPLQLVALVGEPLDPETWHWTHDVLGGGRLFVN
FT                   NTYGQTETGTAWASSMVGLTEGRPGSCGHPLPGYRAAVVHEDGTPCGPNELGSLTLTEP
FT                   FPCLARTVWGDHDRYVETYLSEFPGKYAAADAALLDSDGQLWVTGRLDDVMNVAGHRLG
FT                   TMEMEAALLTHPAVSEAAVVAMPDDIKGAVPVAFVVPRAGIRLDTDLTWLENELADAVV
FT                   SGVGAIARPGRVVVTPTVPRTRSGKIMRRLLRDLLLTGEVKGDLTSLENPDALETVRER
FT                   LGGAAAG"
     MDPALLTTPL VSPTDALKKT APVTPERAQQ LRDMPAGDYW LSVASELTWD VPPTTALEGT        60
     FGDFQYFPGA KGNVSVNCLD RHPKNRVALY YEREDGLKET WSYGDLTDAT ARFAAALQDL       120
     GVDKGDRVAI YLSNVPEAFI AIHACYRIGA IYSVIFAGFS ASAVRDRLTD AQPKVVVCTD       180
     GTLRRGRNIP LKATLDEALE GLEKPTVIVA RRLDPFLPLG ENELDFAELL EKTTRRAAPV       240
     SLDANDPGFI IYTSGTTSKP KGLVHSGIGF LTGTYANVKW ALNLQPDDVY WCTADVGWLT       300
     FPIFALVGGL AHGATHVIYE GSIDTPTPER PYQIIERYRA DKVFTAPTAL RMLRRSGDEA       360
     LARYDLSPLQ LVALVGEPLD PETWHWTHDV LGGGRLFVNN TYGQTETGTA WASSMVGLTE       420
     GRPGSCGHPL PGYRAAVVHE DGTPCGPNEL GSLTLTEPFP CLARTVWGDH DRYVETYLSE       480
     FPGKYAAADA ALLDSDGQLW VTGRLDDVMN VAGHRLGTME MEAALLTHPA VSEAAVVAMP       540
     DDIKGAVPVA FVVPRAGIRL DTDLTWLENE LADAVVSGVG AIARPGRVVV TPTVPRTRSG       600
     KIMRRLLRDL LLTGEVKGDL TSLENPDALE TVRERLGGAA AG                          642
//

If you have problems or comments...

PBIL Back to PBIL home page