(data stored in ACNUC30630 zone)

EMBL: AE000513.PE454

AE000513.PE454       Location/Qualifiers
FT   CDS             complement(469213..469884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10054"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:3M33"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX47"
FT                   /protein_id="AAF10054.1"
FT                   /translation="MNHSRESYDRLARELGGYRHPWARVLSGPDPELTFDLWLSRLLTP
FT                   QTRVLEAGCGHGPDAARFGPQAARWAAYDFSPELLKLARANAPHADVYEWNGKGELPAG
FT                   LGAPFGLIVSRRGPTSVILRLPELAAPDAHFLYVGPRLNVPEVPERLAAVGWDIVAEDH
FT                   VSVLAHAPTWEDWQMRGEFMGKLARRADWDAEATVRGMPYREERHLVLARQLGVARKLG
FT                   A"
     MNHSRESYDR LARELGGYRH PWARVLSGPD PELTFDLWLS RLLTPQTRVL EAGCGHGPDA        60
     ARFGPQAARW AAYDFSPELL KLARANAPHA DVYEWNGKGE LPAGLGAPFG LIVSRRGPTS       120
     VILRLPELAA PDAHFLYVGP RLNVPEVPER LAAVGWDIVA EDHVSVLAHA PTWEDWQMRG       180
     EFMGKLARRA DWDAEATVRG MPYREERHLV LARQLGVARK LGA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page