(data stored in ACNUC30630 zone)

EMBL: AE000513.PE46

AE000513.PE46        Location/Qualifiers
FT   CDS             45124..45321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09649"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA3"
FT                   /protein_id="AAF09649.1"
FT                   /translation="MTPEFLRRRNALWAKLRSLPPGSPEFETVLGDLAQLIGWDRPRIL
FT                   AGLGLNEPDSESNMSPGERP"
     MTPEFLRRRN ALWAKLRSLP PGSPEFETVL GDLAQLIGWD RPRILAGLGL NEPDSESNMS        60
     PGERP                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page