(data stored in ACNUC30630 zone)

EMBL: AE000513.PE466

AE000513.PE466       Location/Qualifiers
FT   CDS             483549..484448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:D21139 PID:415267 GB:U00096 SP:P76055
FT                   PID:1787606 percent identity: 76.90; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10060"
FT                   /db_xref="GOA:Q9RX35"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX35"
FT                   /protein_id="AAF10060.1"
FT                   /translation="MTQALTPTVSNTAQPDPARLLAPIVRQVGQAIGDYRMIEQGDRVM
FT                   VCLSGGKDSYTLLDVLLHLQKKAPIDFEVVAVNLDQGQPGFPKDVLPRYLTALGVRHDI
FT                   LTEDTYSVVKEKTPEGKTTCSLCSRLRRGILYQHAREIGATKIALGHHREDILETLFMN
FT                   MFFGARLKAMPPKLQSDDGTNVVIRPLAYVAEADIIRYAQAREFPVIPCNLCGAQPNLQ
FT                   RKVVGDMLEGWEREHPGRLNNILRSLTRVTPSHLLDRELYDFASLSVTPAQGDTGFDAE
FT                   SFPEREFMAGLSELSLLQ"
     MTQALTPTVS NTAQPDPARL LAPIVRQVGQ AIGDYRMIEQ GDRVMVCLSG GKDSYTLLDV        60
     LLHLQKKAPI DFEVVAVNLD QGQPGFPKDV LPRYLTALGV RHDILTEDTY SVVKEKTPEG       120
     KTTCSLCSRL RRGILYQHAR EIGATKIALG HHREDILETL FMNMFFGARL KAMPPKLQSD       180
     DGTNVVIRPL AYVAEADIIR YAQAREFPVI PCNLCGAQPN LQRKVVGDML EGWEREHPGR       240
     LNNILRSLTR VTPSHLLDRE LYDFASLSVT PAQGDTGFDA ESFPEREFMA GLSELSLLQ        299
//

If you have problems or comments...

PBIL Back to PBIL home page