(data stored in ACNUC30630 zone)

EMBL: AE000513.PE468

AE000513.PE468       Location/Qualifiers
FT   CDS             complement(485078..486064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0482"
FT                   /product="B-cell receptor associated protein-related
FT                   protein"
FT                   /note="similar to GP:1922935 percent identity: 54.32;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10061"
FT                   /db_xref="GOA:Q9RX33"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX33"
FT                   /protein_id="AAF10061.1"
FT                   /translation="MTQRPDNTTPDNANPKRQRVPGVRPSGPGLTTNRALLLGGLALAA
FT                   VLLFQSVRVVPAGFVGVGFNKLSGQLSTLQEGVHFVVPGIQQLNLYDARLQEVTLSNTA
FT                   RDGDEGAINARSKEGLGITAEVTVQYRIDRNQAAALHKQLGHDYQRTVIRPQVRSKVRD
FT                   AIGQFGAAELISTERKQVEESVTKALREEFSRNNLMLDSVLLRELKIPDSVAKAIEEKQ
FT                   TAEQQVAVQKNRLQQAQISAQQAVVDAEGKAKAAVATARGEAEALSLRGKALRENPQLI
FT                   QLTVAEKLSPGIQTVMLPADGNFLLNLQDLGRAANANGQNGNGAGQP"
     MTQRPDNTTP DNANPKRQRV PGVRPSGPGL TTNRALLLGG LALAAVLLFQ SVRVVPAGFV        60
     GVGFNKLSGQ LSTLQEGVHF VVPGIQQLNL YDARLQEVTL SNTARDGDEG AINARSKEGL       120
     GITAEVTVQY RIDRNQAAAL HKQLGHDYQR TVIRPQVRSK VRDAIGQFGA AELISTERKQ       180
     VEESVTKALR EEFSRNNLML DSVLLRELKI PDSVAKAIEE KQTAEQQVAV QKNRLQQAQI       240
     SAQQAVVDAE GKAKAAVATA RGEAEALSLR GKALRENPQL IQLTVAEKLS PGIQTVMLPA       300
     DGNFLLNLQD LGRAANANGQ NGNGAGQP                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page