(data stored in ACNUC30630 zone)

EMBL: AE000513.PE472

AE000513.PE472       Location/Qualifiers
FT   CDS             complement(489195..489716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX29"
FT                   /protein_id="AAF10076.1"
FT                   /translation="MEMALRHLLIRSPGGWATVRPMNKLLPLLACAALLPSCAPTFNAL
FT                   SRADRTPVPAPSAPLAAGQTWDVEGGSLAVGSRMTFRLTEIFETAPGVYSNLDAAGLLA
FT                   AQRGRAPEGTTLFPAVSLNRLGQRLDFYWSENGTDYDCRLENATPNATRLTGRLLLSGS
FT                   EFGGCTAQLR"
     MEMALRHLLI RSPGGWATVR PMNKLLPLLA CAALLPSCAP TFNALSRADR TPVPAPSAPL        60
     AAGQTWDVEG GSLAVGSRMT FRLTEIFETA PGVYSNLDAA GLLAAQRGRA PEGTTLFPAV       120
     SLNRLGQRLD FYWSENGTDY DCRLENATPN ATRLTGRLLL SGSEFGGCTA QLR              173
//

If you have problems or comments...

PBIL Back to PBIL home page