(data stored in ACNUC30630 zone)

EMBL: AE000513.PE488

AE000513.PE488       Location/Qualifiers
FT   CDS             503614..504843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0502"
FT                   /product="alanyl-tRNA synthetase-related protein"
FT                   /note="similar to GB:AE000782 percent identity: 47.11;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10082"
FT                   /db_xref="GOA:Q9RX13"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX13"
FT                   /protein_id="AAF10082.1"
FT                   /translation="MGKAAPGCLPGARSPILPPMTRPLYHDPYQPLTFAASVVDVQGQE
FT                   VALAATAFYPESGGQSSDVGLLRWPGSEARVTHARKDKATGTVWHRVDGELPPVGAEVT
FT                   GEVDPGPRWRHTQRHSAEHLLAQAFRRVNPAFEVASVNMTGPECTIDFLGDPGEADIRA
FT                   AEALLRETLGRDELTLETPIVPEAELVNYPLRRESKVGGQVRLVMFRGSDGDFFDVSAC
FT                   GGTHVPGAAMCAPVVILRTERVRGGQVRVVFMAGEEASEYLSGVYQSARTLAQEFSAPV
FT                   DKLPERVAALRADLSAARADADALRARLAAQLVAAASAEGTPPLRLLTLDNAALLAPVL
FT                   TAVPAGEVLAAVGPGGRCGVASAHPDVKAGDVLRAALAVTGGKGGGKPDLAQGSTADEG
FT                   GFLEAVRQVL"
     MGKAAPGCLP GARSPILPPM TRPLYHDPYQ PLTFAASVVD VQGQEVALAA TAFYPESGGQ        60
     SSDVGLLRWP GSEARVTHAR KDKATGTVWH RVDGELPPVG AEVTGEVDPG PRWRHTQRHS       120
     AEHLLAQAFR RVNPAFEVAS VNMTGPECTI DFLGDPGEAD IRAAEALLRE TLGRDELTLE       180
     TPIVPEAELV NYPLRRESKV GGQVRLVMFR GSDGDFFDVS ACGGTHVPGA AMCAPVVILR       240
     TERVRGGQVR VVFMAGEEAS EYLSGVYQSA RTLAQEFSAP VDKLPERVAA LRADLSAARA       300
     DADALRARLA AQLVAAASAE GTPPLRLLTL DNAALLAPVL TAVPAGEVLA AVGPGGRCGV       360
     ASAHPDVKAG DVLRAALAVT GGKGGGKPDL AQGSTADEGG FLEAVRQVL                   409
//

If you have problems or comments...

PBIL Back to PBIL home page