(data stored in ACNUC30630 zone)

EMBL: AE000513.PE497

AE000513.PE497       Location/Qualifiers
FT   CDS             complement(515856..517352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0511"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to GB:L77117 SP:Q57855 PID:1591118 percent
FT                   identity: 67.17; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10090"
FT                   /db_xref="GOA:Q9RX04"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX04"
FT                   /protein_id="AAF10090.1"
FT                   /translation="MSGPGHPGNTDPIRLEHVSVQLGGVPVLRDVTLNVERGEFLAIIG
FT                   ASGGGKSTLLRVIAGLQLPHAGRVEVASPPALVFQDYRLLPWRSALRNVQLPADLGAAA
FT                   GGNGGLDAKEALRLVGLEATPTIFRRISGGMRARVALARALAQSGDILLLDEPFAALDA
FT                   LVRERFNEELRHLHEKTGRTTVLVTHSIREAALLADRVAVLRGGQLVEVLDTRGAGRVS
FT                   AYTDGIEARLRDLLGAGDSTRLQVAPRRRPSASALLPLLALLLAGIAWQVAAVRLAQPF
FT                   LLPAPAAVWAKLTGNAPTLFASLWVTARTALLGTLLGGLGGLLLGYPIAKSRALERFLS
FT                   PFIVASQSTPIVVLAPLLVSWLGFGSLPAVLVSALSALYPVLVSTLIGVREVDHAYHEL
FT                   FHSLRATPWQRLTRLELPGALPVMLGGLRLAASLALIGAVVWEFTDPNQKGLGFRVQEA
FT                   GIYQDKAGQFAAIALLIVFGVLLYGAVTALERWAARRRGQ"
     MSGPGHPGNT DPIRLEHVSV QLGGVPVLRD VTLNVERGEF LAIIGASGGG KSTLLRVIAG        60
     LQLPHAGRVE VASPPALVFQ DYRLLPWRSA LRNVQLPADL GAAAGGNGGL DAKEALRLVG       120
     LEATPTIFRR ISGGMRARVA LARALAQSGD ILLLDEPFAA LDALVRERFN EELRHLHEKT       180
     GRTTVLVTHS IREAALLADR VAVLRGGQLV EVLDTRGAGR VSAYTDGIEA RLRDLLGAGD       240
     STRLQVAPRR RPSASALLPL LALLLAGIAW QVAAVRLAQP FLLPAPAAVW AKLTGNAPTL       300
     FASLWVTART ALLGTLLGGL GGLLLGYPIA KSRALERFLS PFIVASQSTP IVVLAPLLVS       360
     WLGFGSLPAV LVSALSALYP VLVSTLIGVR EVDHAYHELF HSLRATPWQR LTRLELPGAL       420
     PVMLGGLRLA ASLALIGAVV WEFTDPNQKG LGFRVQEAGI YQDKAGQFAA IALLIVFGVL       480
     LYGAVTALER WAARRRGQ                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page