(data stored in ACNUC30630 zone)

EMBL: AE000513.PE507

AE000513.PE507       Location/Qualifiers
FT   CDS             524080..524475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10101"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ4"
FT                   /protein_id="AAF10101.1"
FT                   /translation="MTGAGTPGRRSPRALIPGAVSLAAVQVVPASLTADGRPALALACY
FT                   TTRHRVTLAHLPSGAAWSLARPPALPNERDEREGLTLARLGGARLTLEHEGRRAVLDVP
FT                   AVRLLRELCEALGTYDRSPVEGLGRPA"
     MTGAGTPGRR SPRALIPGAV SLAAVQVVPA SLTADGRPAL ALACYTTRHR VTLAHLPSGA        60
     AWSLARPPAL PNERDEREGL TLARLGGARL TLEHEGRRAV LDVPAVRLLR ELCEALGTYD       120
     RSPVEGLGRP A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page