(data stored in ACNUC30630 zone)

EMBL: AE000513.PE51

AE000513.PE51        Location/Qualifiers
FT   CDS             complement(48296..49051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09650"
FT                   /db_xref="GOA:Q9RY98"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY98"
FT                   /protein_id="AAF09650.1"
FT                   /translation="MPSLQVCLNGARSQAEHPAVPHTPAELTRDVAQLFAAGARAFHLH
FT                   VYRGGQQTLAPEAVADTLHAIRAVCPDAELAISTAEGIAATPAERARLVAGWTAWPDTL
FT                   CVNLSETGIDDVLALAEARGVALEAGLWTPADVQKFRTLQHLSWRRVLLEPLSGDPDTA
FT                   HAELTILLGALNDFRPDLPRLAHGIDDATWPLLRRAAALGFESRIGFEDVLTLPDQSTP
FT                   AGNLDLYQAGRRLMRAGEAEASRLAHHRT"
     MPSLQVCLNG ARSQAEHPAV PHTPAELTRD VAQLFAAGAR AFHLHVYRGG QQTLAPEAVA        60
     DTLHAIRAVC PDAELAISTA EGIAATPAER ARLVAGWTAW PDTLCVNLSE TGIDDVLALA       120
     EARGVALEAG LWTPADVQKF RTLQHLSWRR VLLEPLSGDP DTAHAELTIL LGALNDFRPD       180
     LPRLAHGIDD ATWPLLRRAA ALGFESRIGF EDVLTLPDQS TPAGNLDLYQ AGRRLMRAGE       240
     AEASRLAHHR T                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page