(data stored in ACNUC30630 zone)

EMBL: AE000513.PE517

AE000513.PE517       Location/Qualifiers
FT   CDS             complement(533860..534480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0531"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10114"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY4"
FT                   /protein_id="AAF10114.1"
FT                   /translation="MKPPHMAGTGRGQAGGLAQSLPESTASGAACIFVCVKAPQKPLKP
FT                   VFYSGAEAKTPAQTGKTVENGAGGLSRIVSPPTAPITSRPTPTHTGTAQGEREKPAPSA
FT                   QKLFTLPPLGGEGSPGGFRGEVFSTPTPQVLAFTPSPRVLYRELCEQHASLSEYIEREA
FT                   PEMRARGEYDALGELEKIAGRLLDRLSELQASGAHLGSAGGAR"
     MKPPHMAGTG RGQAGGLAQS LPESTASGAA CIFVCVKAPQ KPLKPVFYSG AEAKTPAQTG        60
     KTVENGAGGL SRIVSPPTAP ITSRPTPTHT GTAQGEREKP APSAQKLFTL PPLGGEGSPG       120
     GFRGEVFSTP TPQVLAFTPS PRVLYRELCE QHASLSEYIE REAPEMRARG EYDALGELEK       180
     IAGRLLDRLS ELQASGAHLG SAGGAR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page