(data stored in ACNUC30630 zone)

EMBL: AE000513.PE519

AE000513.PE519       Location/Qualifiers
FT   CDS             complement(534930..535760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0533"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10115"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY2"
FT                   /protein_id="AAF10115.1"
FT                   /translation="MSAPVTLPTPKRVNVWGAYVIRVNGGCVYLPVQIVTGGWLGEPRR
FT                   VEVELMAHDVPTLGNVTPDGSLSVHPDPWTARHYRRAVMRGAGVYRWGLWAMLAPGRPA
FT                   AKPDAQAGAALGGEPVNGAEQLAGFAAWAAPVEKMSLGLPRTYIAAPQPAYLTEKLTTA
FT                   AQYGYHWGNILLSLAKHLPGGPQAVVKQLMHGFEPLGAQLRASLYSFVLQLPKGREHRN
FT                   ERRQFWRTVRVLLRVLRRMAPRKPKRRPPVRRAPRPLYSRAIPPAAPLAPPALA"
     MSAPVTLPTP KRVNVWGAYV IRVNGGCVYL PVQIVTGGWL GEPRRVEVEL MAHDVPTLGN        60
     VTPDGSLSVH PDPWTARHYR RAVMRGAGVY RWGLWAMLAP GRPAAKPDAQ AGAALGGEPV       120
     NGAEQLAGFA AWAAPVEKMS LGLPRTYIAA PQPAYLTEKL TTAAQYGYHW GNILLSLAKH       180
     LPGGPQAVVK QLMHGFEPLG AQLRASLYSF VLQLPKGREH RNERRQFWRT VRVLLRVLRR       240
     MAPRKPKRRP PVRRAPRPLY SRAIPPAAPL APPALA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page