(data stored in ACNUC30630 zone)

EMBL: AE000513.PE522

AE000513.PE522       Location/Qualifiers
FT   CDS             complement(540833..541438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10120"
FT                   /db_xref="GOA:Q9RWX9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX9"
FT                   /protein_id="AAF10120.1"
FT                   /translation="MSTSRLRGDTNPYIAFSDLTLNLIFVLIFFIGGILAVGQAGWDQV
FT                   KYRKAQELVVAAVRRAPLSVRPQLLSPVQRNDPPGAQRWVFRSENMFVGESAVLTPEGE
FT                   TALVDFAQVLRSQKKNWKRIRIEGHTQTSRPNTPERWDLSATRASAVAAAFYLRGGISP
FT                   NRLAVAARGGQTPFNGHKFAPQNERVEIVVEYAQKSTP"
     MSTSRLRGDT NPYIAFSDLT LNLIFVLIFF IGGILAVGQA GWDQVKYRKA QELVVAAVRR        60
     APLSVRPQLL SPVQRNDPPG AQRWVFRSEN MFVGESAVLT PEGETALVDF AQVLRSQKKN       120
     WKRIRIEGHT QTSRPNTPER WDLSATRASA VAAAFYLRGG ISPNRLAVAA RGGQTPFNGH       180
     KFAPQNERVE IVVEYAQKST P                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page