(data stored in ACNUC30630 zone)

EMBL: AE000513.PE529

AE000513.PE529       Location/Qualifiers
FT   CDS             549374..550057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0543"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to SP:P54554 PID:1303968 GB:AL009126 percent
FT                   identity: 53.80; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10118"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX2"
FT                   /protein_id="AAF10118.1"
FT                   /translation="MANLSSSTVMLTGAGGSLANAIAQELEDAGAQMVLVGRGEDLAWA
FT                   ADRYPAKDVLDLDLTDPASVEALRKVKVDTLVHTAGHYSVQDIQKAGAEDYADMFDSNM
FT                   LTLFHAVQGVLPAMLKQKDGQVLAVSAGQAARLSGPKAALYTASKAAVAAYILSLHDEL
FT                   KGKGVRGCVLYPMGAVDTPENRDEGMKWDAMIDPRGLAKSVAHILSRPDRAHITELKVY
FT                   PDEEE"
     MANLSSSTVM LTGAGGSLAN AIAQELEDAG AQMVLVGRGE DLAWAADRYP AKDVLDLDLT        60
     DPASVEALRK VKVDTLVHTA GHYSVQDIQK AGAEDYADMF DSNMLTLFHA VQGVLPAMLK       120
     QKDGQVLAVS AGQAARLSGP KAALYTASKA AVAAYILSLH DELKGKGVRG CVLYPMGAVD       180
     TPENRDEGMK WDAMIDPRGL AKSVAHILSR PDRAHITELK VYPDEEE                     227
//

If you have problems or comments...

PBIL Back to PBIL home page