(data stored in ACNUC30630 zone)

EMBL: AE000513.PE530

AE000513.PE530       Location/Qualifiers
FT   CDS             550134..550901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:Pyro_h percent identity: 56.68;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10119"
FT                   /db_xref="GOA:Q9RWX1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX1"
FT                   /protein_id="AAF10119.1"
FT                   /translation="MISAMMLAVIGVGLLAGVLGAILGLGGGVVVVPALEFVLPRFGHD
FT                   ITISQAVAVSQIGVLAVGLSGAAAYLQQGLVRARTGYLLSPYTIIGGAVGSFLGLVLPA
FT                   RAVATVFALLLFYSAYNLLRGLKRVEVEREPSKLVPPAMTFAGVMSGLLGIGGGTVQVP
FT                   VLNLMQGMPIRQAIATSTFIMGLTAVGNALVYQAGGLLDVKLAAGVALGVLIGAKAGAS
FT                   LQSRIPAAQLKLFFSLLLIFTAGQLLWKYWGHA"
     MISAMMLAVI GVGLLAGVLG AILGLGGGVV VVPALEFVLP RFGHDITISQ AVAVSQIGVL        60
     AVGLSGAAAY LQQGLVRART GYLLSPYTII GGAVGSFLGL VLPARAVATV FALLLFYSAY       120
     NLLRGLKRVE VEREPSKLVP PAMTFAGVMS GLLGIGGGTV QVPVLNLMQG MPIRQAIATS       180
     TFIMGLTAVG NALVYQAGGL LDVKLAAGVA LGVLIGAKAG ASLQSRIPAA QLKLFFSLLL       240
     IFTAGQLLWK YWGHA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page