(data stored in ACNUC30630 zone)

EMBL: AE000513.PE537

AE000513.PE537       Location/Qualifiers
FT   CDS             complement(556197..557441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0551"
FT                   /product="glutaryl-CoA dehydrogenase, putative"
FT                   /note="similar to GB:AE000782 percent identity: 59.75;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10130"
FT                   /db_xref="GOA:Q9RWW4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW4"
FT                   /protein_id="AAF10130.1"
FT                   /translation="MNDKQLKQLSRALGVGGSGRQRVLPAADGDYYDYLDTLTDSQVEV
FT                   AGRVHDFMRAEVMPIMNEYWSRDEFPRDLIGKMRELNLLRSIWNEDGTRKPDATLIEGV
FT                   VILEACRVDVSTAVFFGVHGGLATASIALGSDEEQKKRWLPDMLDMKKIGAFGLTEPEG
FT                   GSQVSEGMRTTCRRDGDGWVLNGEKKWIGNSTFSDFTVIWARDEETNEVRGFVVEAGTP
FT                   GYDVEKIQGKIALRMVENGHITLKDCRVADANRLQAVQGWETVSQVLKLTRAGVAWQGV
FT                   GCAMGAYELALAYTQTRKQFGKRIGEFQLIQSHLTHMLADVTAMLGMVMRLSHIADEGR
FT                   MDDAHAALAKVHTAARCREVVARAREVFGGNGILLEHGVAKHFCDTEAIYSYEGTNEIN
FT                   TLVVGRAITGLSAFV"
     MNDKQLKQLS RALGVGGSGR QRVLPAADGD YYDYLDTLTD SQVEVAGRVH DFMRAEVMPI        60
     MNEYWSRDEF PRDLIGKMRE LNLLRSIWNE DGTRKPDATL IEGVVILEAC RVDVSTAVFF       120
     GVHGGLATAS IALGSDEEQK KRWLPDMLDM KKIGAFGLTE PEGGSQVSEG MRTTCRRDGD       180
     GWVLNGEKKW IGNSTFSDFT VIWARDEETN EVRGFVVEAG TPGYDVEKIQ GKIALRMVEN       240
     GHITLKDCRV ADANRLQAVQ GWETVSQVLK LTRAGVAWQG VGCAMGAYEL ALAYTQTRKQ       300
     FGKRIGEFQL IQSHLTHMLA DVTAMLGMVM RLSHIADEGR MDDAHAALAK VHTAARCREV       360
     VARAREVFGG NGILLEHGVA KHFCDTEAIY SYEGTNEINT LVVGRAITGL SAFV             414
//

If you have problems or comments...

PBIL Back to PBIL home page