(data stored in ACNUC30630 zone)

EMBL: AE000513.PE539

AE000513.PE539       Location/Qualifiers
FT   CDS             complement(558279..559697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10137"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW2"
FT                   /protein_id="AAF10137.1"
FT                   /translation="MPRSAPSAPRRVTARSPLWLSALLLVPALLTACTSSEPEPAAIPK
FT                   RLQDTRTFNPITPTLTALPGAQLFQGLYPGIQGQAAYVVEVPHNWNGTLVMYAHGYAGM
FT                   GADLKVQTPSLRAEWLAQGYAWGASSYSSNYYDVRAGLEDTNALALEFSRLTGQAAPRK
FT                   TVIMGVSMGGQVASAAVEAETQQTARSRVNYAASMPVCAVLDPVYEFQWLGDYTQAAAQ
FT                   LAGYGGTYPNADFQKNLPAIKAALFTSSSGPLWQENGGAGANLRDLARQLTGGERPVFE
FT                   LGFRTGALQNAVLGTGGSDGTVNGILARNLYDNRTVTYRWTTGPVPTPAEVSFNAALPR
FT                   VAADQGANPRLPGSVRWLPVVEGRVKVPVLTMHTLGDFYVPFKHEQNYRRAVEGQGNGR
FT                   WLAQRAVRAPGHCDFVKAELAEGFRDLMAWEQTGQKPAGDDVLTPSVVADPTYGCTFTR
FT                   ETRPGVAACPAGKP"
     MPRSAPSAPR RVTARSPLWL SALLLVPALL TACTSSEPEP AAIPKRLQDT RTFNPITPTL        60
     TALPGAQLFQ GLYPGIQGQA AYVVEVPHNW NGTLVMYAHG YAGMGADLKV QTPSLRAEWL       120
     AQGYAWGASS YSSNYYDVRA GLEDTNALAL EFSRLTGQAA PRKTVIMGVS MGGQVASAAV       180
     EAETQQTARS RVNYAASMPV CAVLDPVYEF QWLGDYTQAA AQLAGYGGTY PNADFQKNLP       240
     AIKAALFTSS SGPLWQENGG AGANLRDLAR QLTGGERPVF ELGFRTGALQ NAVLGTGGSD       300
     GTVNGILARN LYDNRTVTYR WTTGPVPTPA EVSFNAALPR VAADQGANPR LPGSVRWLPV       360
     VEGRVKVPVL TMHTLGDFYV PFKHEQNYRR AVEGQGNGRW LAQRAVRAPG HCDFVKAELA       420
     EGFRDLMAWE QTGQKPAGDD VLTPSVVADP TYGCTFTRET RPGVAACPAG KP               472
//

If you have problems or comments...

PBIL Back to PBIL home page