(data stored in ACNUC30630 zone)

EMBL: AE000513.PE544

AE000513.PE544       Location/Qualifiers
FT   CDS             complement(563314..564306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0558"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="similar to GB:M14742 SP:P00953 PID:143784 percent
FT                   identity: 64.42; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10134"
FT                   /db_xref="GOA:Q9RWV7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWV7"
FT                   /protein_id="AAF10134.1"
FT                   /translation="MSRVFSGIQPTGDPHIGNYFGAMQNYVRLGEQYGKQSLYCVVDLH
FT                   AITNPGAFDPQTLAQKTFDMAVANFAIGLDPSKVVFFVQSHVPEHQELSWIFTCVTPVG
FT                   ELERMTQYKDKSAQFESVPSGLLMYPALMAADILLYKADIVPVGEDQTQHIELTREIAR
FT                   KFNHNFGETFTEPKAVYNKEALRIPGVDGQGKMSKSKGNTIGILEPFGDIWQKLRVAPT
FT                   DPARVRRTDPGDPDKCLIGDYHKLFSPPETLETVYQGCRTAGIGCVDCKKMLMTHITEH
FT                   LDPIQTRAAQLRADPDYVRDALRQGDQEARAIASEVMDEVRQKVGFLKL"
     MSRVFSGIQP TGDPHIGNYF GAMQNYVRLG EQYGKQSLYC VVDLHAITNP GAFDPQTLAQ        60
     KTFDMAVANF AIGLDPSKVV FFVQSHVPEH QELSWIFTCV TPVGELERMT QYKDKSAQFE       120
     SVPSGLLMYP ALMAADILLY KADIVPVGED QTQHIELTRE IARKFNHNFG ETFTEPKAVY       180
     NKEALRIPGV DGQGKMSKSK GNTIGILEPF GDIWQKLRVA PTDPARVRRT DPGDPDKCLI       240
     GDYHKLFSPP ETLETVYQGC RTAGIGCVDC KKMLMTHITE HLDPIQTRAA QLRADPDYVR       300
     DALRQGDQEA RAIASEVMDE VRQKVGFLKL                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page