(data stored in ACNUC30630 zone)

EMBL: AE000513.PE55

AE000513.PE55        Location/Qualifiers
FT   CDS             51060..52361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0056"
FT                   /product="benzoate membrane transport protein, putative"
FT                   /note="similar to GB:M76990 SP:P07775 PID:141751 percent
FT                   identity: 61.68; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09646"
FT                   /db_xref="GOA:Q9RY94"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY94"
FT                   /protein_id="AAF09646.1"
FT                   /translation="MRVSFSVKCSRQAAKSSDCERRTLGNMTTLSPARRSFWQDTHPSA
FT                   VLAGLIAVVIGWAGPNVLIYSVQQAGHLSDAAAMSWLWGHAVITGIVGIYLSLRTRMPI
FT                   LSTWSTPGIALLVTALPGMPFAEAVGAFLVSAALVFLLGTFAPLTRAVQAIPTHLAAAL
FT                   NAAILLPFAFKAVQAFGTQPLLVGLMVVTYFLGRQFAPRWAVALVLLVGVAASALLGAW
FT                   HPAPVPLAPTVPQVVAPAFSVRAMLNLALPLTLLAFTGQFVPGFGVLKANGYEPAPGPI
FT                   LRACGVASAAAALVGCHNLTLGALLANIVSGPEAHPDAARRYTAAIWAGIFNILFGLFA
FT                   GTFLHLMGILPAEALAALAGLALLAATGGSLQAAFTPGQSASGRGAAQPGSLAAAVIIA
FT                   VTLSGVSFFGIGAAFWGILAGLAVHGLEGVRRAG"
     MRVSFSVKCS RQAAKSSDCE RRTLGNMTTL SPARRSFWQD THPSAVLAGL IAVVIGWAGP        60
     NVLIYSVQQA GHLSDAAAMS WLWGHAVITG IVGIYLSLRT RMPILSTWST PGIALLVTAL       120
     PGMPFAEAVG AFLVSAALVF LLGTFAPLTR AVQAIPTHLA AALNAAILLP FAFKAVQAFG       180
     TQPLLVGLMV VTYFLGRQFA PRWAVALVLL VGVAASALLG AWHPAPVPLA PTVPQVVAPA       240
     FSVRAMLNLA LPLTLLAFTG QFVPGFGVLK ANGYEPAPGP ILRACGVASA AAALVGCHNL       300
     TLGALLANIV SGPEAHPDAA RRYTAAIWAG IFNILFGLFA GTFLHLMGIL PAEALAALAG       360
     LALLAATGGS LQAAFTPGQS ASGRGAAQPG SLAAAVIIAV TLSGVSFFGI GAAFWGILAG       420
     LAVHGLEGVR RAG                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page