(data stored in ACNUC30630 zone)

EMBL: AE000513.PE559

AE000513.PE559       Location/Qualifiers
FT   CDS             581498..584413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10153"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU2"
FT                   /protein_id="AAF10153.1"
FT                   /translation="MKVWSPRRRSQLKHGEQKQRRSRGLTRLLLAAGFAFSTLGGLAEA
FT                   RTVKIVTAQTLELRNVDGQELVIIASPDAAGVELQVDDDQVRARRVEFNRTRRTLTLIG
FT                   AASYRTAKDGQTLSGDNLVVNLGDESLTGQDVLISDRELEIRGQEVERVPGQLRAKNGY
FT                   FTPCAKCGRTTNDYAFRAERLVVYPGDRLIAYRAQLLLAEVPVLYLPVVVLPLNDEARQ
FT                   PKVQVGRDALDGLTVEADLPFAVGSSVLGTGLVRYYQNRAPSLGGGVDLRAYAPFAAVD
FT                   RADLYLLLLPKPLDAQGNVRGEGGYDTDLNFSVRGRVPLSEATRDLDYAFTMQRRDIGR
FT                   SETDPERGVTRSELKASVEYPLYRAELNVLGRSGPEPETAITQPYRKKEVVLDPKPFSV
FT                   GGLSADFKVTAGEYSAASNPFSPSAVREGVNITTTRLEEAQELRYSRPLWTGATFEFSN
FT                   SFVGRYYGTGARTVQLSLAGQLTQRWGVQSRQSLSLRQEYLRYEGTSPFAFDAVSGRRL
FT                   NAPLSLNLNLVPVPDTTFTVGYVRDPFLKTDTQQPARFGVTVNRRPVNLTAALAYNIGT
FT                   GELDNFTYAVTLGDPESGKLRLVPAVPARPATPTTPAQPAVPAHYTRSSAWPAPRLTLG
FT                   LSGGYSRVTSIGTPGKDAPSGLQPFTVRATVAGDDRSSNFSVAATFNPDLDPQLSSVNT
FT                   EYTLARGFDTVLSPLTVSGRETLGVQYPRLTGNHTVTWRDYTFTQAHDLNLDQSETARE
FT                   SGTVTFSVGNRAGRATNWQLAYGGAYDLRRGGFTRPALTGTLTTSRPGQRLNTSLSYNL
FT                   PGLDQPYSELGRATLDGEWQSGRFSVSGYASYSRVRTGNLTDGNTANDKATDTYTFEPL
FT                   RVGVALGKAEQPSVYLTAALRQRLIYVDGERQGDDPLAPVLGFTLDRCCWAMQGEWDVV
FT                   KGRYRLTVGLPGQFYPLLEGGPDGTRVPLIPSLSRPTTPSR"
     MKVWSPRRRS QLKHGEQKQR RSRGLTRLLL AAGFAFSTLG GLAEARTVKI VTAQTLELRN        60
     VDGQELVIIA SPDAAGVELQ VDDDQVRARR VEFNRTRRTL TLIGAASYRT AKDGQTLSGD       120
     NLVVNLGDES LTGQDVLISD RELEIRGQEV ERVPGQLRAK NGYFTPCAKC GRTTNDYAFR       180
     AERLVVYPGD RLIAYRAQLL LAEVPVLYLP VVVLPLNDEA RQPKVQVGRD ALDGLTVEAD       240
     LPFAVGSSVL GTGLVRYYQN RAPSLGGGVD LRAYAPFAAV DRADLYLLLL PKPLDAQGNV       300
     RGEGGYDTDL NFSVRGRVPL SEATRDLDYA FTMQRRDIGR SETDPERGVT RSELKASVEY       360
     PLYRAELNVL GRSGPEPETA ITQPYRKKEV VLDPKPFSVG GLSADFKVTA GEYSAASNPF       420
     SPSAVREGVN ITTTRLEEAQ ELRYSRPLWT GATFEFSNSF VGRYYGTGAR TVQLSLAGQL       480
     TQRWGVQSRQ SLSLRQEYLR YEGTSPFAFD AVSGRRLNAP LSLNLNLVPV PDTTFTVGYV       540
     RDPFLKTDTQ QPARFGVTVN RRPVNLTAAL AYNIGTGELD NFTYAVTLGD PESGKLRLVP       600
     AVPARPATPT TPAQPAVPAH YTRSSAWPAP RLTLGLSGGY SRVTSIGTPG KDAPSGLQPF       660
     TVRATVAGDD RSSNFSVAAT FNPDLDPQLS SVNTEYTLAR GFDTVLSPLT VSGRETLGVQ       720
     YPRLTGNHTV TWRDYTFTQA HDLNLDQSET ARESGTVTFS VGNRAGRATN WQLAYGGAYD       780
     LRRGGFTRPA LTGTLTTSRP GQRLNTSLSY NLPGLDQPYS ELGRATLDGE WQSGRFSVSG       840
     YASYSRVRTG NLTDGNTAND KATDTYTFEP LRVGVALGKA EQPSVYLTAA LRQRLIYVDG       900
     ERQGDDPLAP VLGFTLDRCC WAMQGEWDVV KGRYRLTVGL PGQFYPLLEG GPDGTRVPLI       960
     PSLSRPTTPS R                                                            971
//

If you have problems or comments...

PBIL Back to PBIL home page