(data stored in ACNUC30630 zone)

EMBL: AE000513.PE570

AE000513.PE570       Location/Qualifiers
FT   CDS             complement(597451..598347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0584"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="similar to PID:560524 SP:Q50453 PID:1694867
FT                   GB:AL123456 percent identity: 67.89; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10164"
FT                   /db_xref="GOA:Q9RWT1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT1"
FT                   /protein_id="AAF10164.1"
FT                   /translation="MTTPDAALPELPDLSQTATLTISCADQPGIVAAVSQFLHNHGANI
FT                   IHSDQHSTDPAGGQFFMRMEFFLGGLDLTREAFERAFEQVVARPLGMDWRLNLASQPKK
FT                   MAVLVSRYDHCFLDLLWRRRRGELNVEIPLILSNHEDLRRDAEMFGIPFHVIPVTKANK
FT                   AEAEAEQVRLMHEAGADFAVLARYMQILSSDFLRGFGRPVINIHHSFLPAFIGANPYRA
FT                   AFNRGVKLIGATSHYVTEELDAGPIIAQDVIPVTHRETPDTLMRMGRDVERQVLARAVK
FT                   AHVEDRVLVYGNKTVVF"
     MTTPDAALPE LPDLSQTATL TISCADQPGI VAAVSQFLHN HGANIIHSDQ HSTDPAGGQF        60
     FMRMEFFLGG LDLTREAFER AFEQVVARPL GMDWRLNLAS QPKKMAVLVS RYDHCFLDLL       120
     WRRRRGELNV EIPLILSNHE DLRRDAEMFG IPFHVIPVTK ANKAEAEAEQ VRLMHEAGAD       180
     FAVLARYMQI LSSDFLRGFG RPVINIHHSF LPAFIGANPY RAAFNRGVKL IGATSHYVTE       240
     ELDAGPIIAQ DVIPVTHRET PDTLMRMGRD VERQVLARAV KAHVEDRVLV YGNKTVVF         298
//

If you have problems or comments...

PBIL Back to PBIL home page