(data stored in ACNUC30630 zone)

EMBL: AE000513.PE574

AE000513.PE574       Location/Qualifiers
FT   CDS             600865..603090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0588"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpA"
FT                   /note="similar to GB:M31045 SP:P15716 PID:145549 PID:499142
FT                   GB:U00096 percent identity: 72.69; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10168"
FT                   /db_xref="GOA:Q9RWS7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS7"
FT                   /protein_id="AAF10168.1"
FT                   /translation="MLSEHLQAALQRAADLAQAAGHEYITQEHLLLALLGDPEAKDALN
FT                   ALGADLNALREALTEQLAELDILDDPDPDFTLGVHRVVQGAVLQLHASGKGKEQADGAR
FT                   VLVELLEEDDSPARAALEAQGVTRLDLLNYLSHGVAKAPGHSRERRVAGVDGELTAEGA
FT                   PAEENPLEAYAQNLTEAAKNGEFDPVIGRGAELERVVHILARRGKNNPVLVGEPGVGKT
FT                   ALAEGLAQRVADGKAPGFLRGASVYALDLGALLAGTRYRGDFEGRLKAVLAALDGQNSV
FT                   LFIDELHTLVGAGATEGGSVDAANLLKPALARGKLRVMGATTPAELRLLEKDRALWRRF
FT                   QTVDVPEPSEADAVQILQGLAPKYAAHHGVTYTPPALEAAVRLSARYLRDRFLPDKAID
FT                   VLDEAGAARSSTGQGGEIDVPDIESTVARMARVPVGAVKAEEVQSLATLEADLNRRVYG
FT                   QEPAVSAVSSAVKLARAGLRNPQKPQGSFLFAGPTGVGKTELARALAERLGVELIRFDM
FT                   SEYQEPHTVARLIGAPPGYVGFDQGGLLTDAVAKNPHAVLLLDEIEKAHPDVYNIFLQL
FT                   MDHGTLTDHAGKKVDGRGLILIFTTNAGAADASRPALGFSREGRAGEQAEAVKRTFTPE
FT                   FRNRLDAVIYFAPLSRTVMTSVVDKFLRELGEQLTERGVTLTVTPAARARLAELGYDPL
FT                   LGARPLARVIEDKLGRPLADELLFGRLKDGGAVKVGVQGGEFSFAVS"
     MLSEHLQAAL QRAADLAQAA GHEYITQEHL LLALLGDPEA KDALNALGAD LNALREALTE        60
     QLAELDILDD PDPDFTLGVH RVVQGAVLQL HASGKGKEQA DGARVLVELL EEDDSPARAA       120
     LEAQGVTRLD LLNYLSHGVA KAPGHSRERR VAGVDGELTA EGAPAEENPL EAYAQNLTEA       180
     AKNGEFDPVI GRGAELERVV HILARRGKNN PVLVGEPGVG KTALAEGLAQ RVADGKAPGF       240
     LRGASVYALD LGALLAGTRY RGDFEGRLKA VLAALDGQNS VLFIDELHTL VGAGATEGGS       300
     VDAANLLKPA LARGKLRVMG ATTPAELRLL EKDRALWRRF QTVDVPEPSE ADAVQILQGL       360
     APKYAAHHGV TYTPPALEAA VRLSARYLRD RFLPDKAIDV LDEAGAARSS TGQGGEIDVP       420
     DIESTVARMA RVPVGAVKAE EVQSLATLEA DLNRRVYGQE PAVSAVSSAV KLARAGLRNP       480
     QKPQGSFLFA GPTGVGKTEL ARALAERLGV ELIRFDMSEY QEPHTVARLI GAPPGYVGFD       540
     QGGLLTDAVA KNPHAVLLLD EIEKAHPDVY NIFLQLMDHG TLTDHAGKKV DGRGLILIFT       600
     TNAGAADASR PALGFSREGR AGEQAEAVKR TFTPEFRNRL DAVIYFAPLS RTVMTSVVDK       660
     FLRELGEQLT ERGVTLTVTP AARARLAELG YDPLLGARPL ARVIEDKLGR PLADELLFGR       720
     LKDGGAVKVG VQGGEFSFAV S                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page