(data stored in ACNUC30630 zone)

EMBL: AE000513.PE577

AE000513.PE577       Location/Qualifiers
FT   CDS             complement(604076..604822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10173"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS4"
FT                   /protein_id="AAF10173.1"
FT                   /translation="MTWLADTLQAAWAVLDEDNAVRGAAGVRPSPAHGLELMGGALAAE
FT                   PEEEQAVQTALAKAAHRDAGQVYAFADGSLFTAQALAQAGFQEVGAYRLLAGPTPEEGP
FT                   PTLEGFTLRPLADVPDLAIRLDALTTYEDRIGHHAVSPTAAEDGAGGYDSTLSLIALDA
FT                   QGRAAGICRAAAEEGYIRIDAPGVRADLRHTPLRQALLLGVCAQARARGIGDISLESWG
FT                   DTPAELAADLALGLEIQFENPIYAAG"
     MTWLADTLQA AWAVLDEDNA VRGAAGVRPS PAHGLELMGG ALAAEPEEEQ AVQTALAKAA        60
     HRDAGQVYAF ADGSLFTAQA LAQAGFQEVG AYRLLAGPTP EEGPPTLEGF TLRPLADVPD       120
     LAIRLDALTT YEDRIGHHAV SPTAAEDGAG GYDSTLSLIA LDAQGRAAGI CRAAAEEGYI       180
     RIDAPGVRAD LRHTPLRQAL LLGVCAQARA RGIGDISLES WGDTPAELAA DLALGLEIQF       240
     ENPIYAAG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page