(data stored in ACNUC30630 zone)

EMBL: AE000513.PE578

AE000513.PE578       Location/Qualifiers
FT   CDS             complement(604906..605406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10174"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWS3"
FT                   /protein_id="AAF10174.1"
FT                   /translation="MKQDDGAGPGLCHGDRLTAWAQETPSPELCLSMSIPHKDDWTRHF
FT                   EALQRGELSVEDWQEFCRRSGRAVGGLPPLKGAQRQAMEEEFDRLRLACQLFLAQAPDF
FT                   ETLAARQTTVGPDYCLLKMLAASALNLLDLPAPSLPAVNAAEEFEVGLPATTFIVFGNN
FT                   AAL"
     MKQDDGAGPG LCHGDRLTAW AQETPSPELC LSMSIPHKDD WTRHFEALQR GELSVEDWQE        60
     FCRRSGRAVG GLPPLKGAQR QAMEEEFDRL RLACQLFLAQ APDFETLAAR QTTVGPDYCL       120
     LKMLAASALN LLDLPAPSLP AVNAAEEFEV GLPATTFIVF GNNAAL                      166
//

If you have problems or comments...

PBIL Back to PBIL home page