(data stored in ACNUC30630 zone)

EMBL: AE000513.PE588

AE000513.PE588       Location/Qualifiers
FT   CDS             complement(614142..614738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0602"
FT                   /product="phosphoglycerate mutase-related protein"
FT                   /note="similar to GB:AE000657 percent identity: 50.67;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10181"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR4"
FT                   /protein_id="AAF10181.1"
FT                   /translation="MNLTLLRHGRSRADDEGVCEGRYDSPLTEVGREHARKLAAYWAAH
FT                   PPGFDQAYCSTLSRASETAALVTAPLGLVPMPSDLLREFDNGPIAGLPFAKAEARYPIP
FT                   AFRHELEAFTVDGGESQAAFRARALLALELVWRGGENVLVVAHGGILNAMLRELTGARR
FT                   AHFAYGDTAFTTVQLSREHMGVTVTGVNLTPHLAE"
     MNLTLLRHGR SRADDEGVCE GRYDSPLTEV GREHARKLAA YWAAHPPGFD QAYCSTLSRA        60
     SETAALVTAP LGLVPMPSDL LREFDNGPIA GLPFAKAEAR YPIPAFRHEL EAFTVDGGES       120
     QAAFRARALL ALELVWRGGE NVLVVAHGGI LNAMLRELTG ARRAHFAYGD TAFTTVQLSR       180
     EHMGVTVTGV NLTPHLAE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page