(data stored in ACNUC30630 zone)

EMBL: AE000513.PE591

AE000513.PE591       Location/Qualifiers
FT   CDS             complement(616958..617641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0605"
FT                   /product="GGDEF family protein"
FT                   /note="similar to PID:1652841 percent identity: 58.40;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10184"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR038733"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWR1"
FT                   /protein_id="AAF10184.1"
FT                   /translation="MLPSLNMTGGHWGRPDLFGPFPRRFSVARPAILSRTPFEEAFEKL
FT                   GSAPLTLAVLDLDHFKVLNDQLGHTEGDRVLKVVERLLSGSLPSGSVVGRIGGDEYAVI
FT                   LPETAAETALILFDEVIRHFQIHRDPQWPRGLGLSVGLAARPAHASEYAELYRAADEAL
FT                   LRAKREGRSRACIYVESKMVLKSNYYPKSQLERLAKLSAALGRTEASLLREALDDLIEK
FT                   YRGEL"
     MLPSLNMTGG HWGRPDLFGP FPRRFSVARP AILSRTPFEE AFEKLGSAPL TLAVLDLDHF        60
     KVLNDQLGHT EGDRVLKVVE RLLSGSLPSG SVVGRIGGDE YAVILPETAA ETALILFDEV       120
     IRHFQIHRDP QWPRGLGLSV GLAARPAHAS EYAELYRAAD EALLRAKREG RSRACIYVES       180
     KMVLKSNYYP KSQLERLAKL SAALGRTEAS LLREALDDLI EKYRGEL                     227
//

If you have problems or comments...

PBIL Back to PBIL home page