(data stored in ACNUC30630 zone)

EMBL: AE000513.PE601

AE000513.PE601       Location/Qualifiers
FT   CDS             626751..627704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0615"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="similar to GB:L04470 SP:Q04778 PID:142469
FT                   PID:1929339 GB:AL009126 percent identity: 59.74; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10192"
FT                   /db_xref="GOA:Q9RWQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ1"
FT                   /protein_id="AAF10192.1"
FT                   /translation="MELRHLRHFVALAEEEHFGRAAERVFVVQQALSSSIRNLEEEVGV
FT                   QLVTRTTRRVQLTPAGEEFLIGARATLAQAAQTVERARRAAQGEVGRLTVGFVSGLAFG
FT                   GLPEIVRRFRELYPAVSVDLRELTAGEQEAALRGGQIDVGLLLLPVRDPALASRPLWRL
FT                   PLVAALPAAHPLASRTTLRIGDLSQEDFVFFPRYLRATYFDQVMHWCADAGFTPHVVQE
FT                   AIEIPTLLSLVAAGVGVFLPIEFFARLALPGVVYRPLEGAPVIEIVAVWRRAAAGEQST
FT                   RPTVQAFLQVAERVLSGENGAGEATPLPVLPTEPPR"
     MELRHLRHFV ALAEEEHFGR AAERVFVVQQ ALSSSIRNLE EEVGVQLVTR TTRRVQLTPA        60
     GEEFLIGARA TLAQAAQTVE RARRAAQGEV GRLTVGFVSG LAFGGLPEIV RRFRELYPAV       120
     SVDLRELTAG EQEAALRGGQ IDVGLLLLPV RDPALASRPL WRLPLVAALP AAHPLASRTT       180
     LRIGDLSQED FVFFPRYLRA TYFDQVMHWC ADAGFTPHVV QEAIEIPTLL SLVAAGVGVF       240
     LPIEFFARLA LPGVVYRPLE GAPVIEIVAV WRRAAAGEQS TRPTVQAFLQ VAERVLSGEN       300
     GAGEATPLPV LPTEPPR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page