(data stored in ACNUC30630 zone)

EMBL: AE000513.PE604

AE000513.PE604       Location/Qualifiers
FT   CDS             631595..632350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0618"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10207"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP8"
FT                   /protein_id="AAF10207.1"
FT                   /translation="MLRPPLLPLLALSLSGCQLLPAAAQSPVRIGQVCGDIVEFSPLGN
FT                   LGHCDLVEARVTLARSANPKTVSGGLFNLKTGAGIALHLGHADGQRGEVSLSPVRGQDW
FT                   QKIFAYDTDYELRVTALDGQGRKLERRVRLHTEKAPYELAWVKTALPKPGDRVVTATIT
FT                   NRTPEAIQAGAVRLDVVCDQLHGTERRTVYFGSDTQSFAANETRQVRLPLLTQRDFQPQ
FT                   PWADVPFTECRNEYVEGLRGRRVIPSRTL"
     MLRPPLLPLL ALSLSGCQLL PAAAQSPVRI GQVCGDIVEF SPLGNLGHCD LVEARVTLAR        60
     SANPKTVSGG LFNLKTGAGI ALHLGHADGQ RGEVSLSPVR GQDWQKIFAY DTDYELRVTA       120
     LDGQGRKLER RVRLHTEKAP YELAWVKTAL PKPGDRVVTA TITNRTPEAI QAGAVRLDVV       180
     CDQLHGTERR TVYFGSDTQS FAANETRQVR LPLLTQRDFQ PQPWADVPFT ECRNEYVEGL       240
     RGRRVIPSRT L                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page