(data stored in ACNUC30630 zone)

EMBL: AE000513.PE611

AE000513.PE611       Location/Qualifiers
FT   CDS             639376..640140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000666 percent identity: 44.79;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10203"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWP1"
FT                   /protein_id="AAF10203.1"
FT                   /translation="MTNMQLGNEGTYSLRDFLAQTAERDNPGEVFELESSKMLEVRVNG
FT                   RIWSKLGAMVAYKGQLSFKREGTLEGGLMKAFKRAVSQEMSPLAKIEGRGVAYLADQGK
FT                   EIQILRLAGESLNVNGNDLLAFEDSVQYDITMQRRVAGMAAGGLFSVRVQGHGMVAVLS
FT                   HGKPLTLRVTPHEPIYTDPNATIAWSGNLQPQLVMDTSLRSIFGRGGGESYQMVFQGDG
FT                   FVVVQPYEEFGAGMLGGESGGGLGRTMGDLFD"
     MTNMQLGNEG TYSLRDFLAQ TAERDNPGEV FELESSKMLE VRVNGRIWSK LGAMVAYKGQ        60
     LSFKREGTLE GGLMKAFKRA VSQEMSPLAK IEGRGVAYLA DQGKEIQILR LAGESLNVNG       120
     NDLLAFEDSV QYDITMQRRV AGMAAGGLFS VRVQGHGMVA VLSHGKPLTL RVTPHEPIYT       180
     DPNATIAWSG NLQPQLVMDT SLRSIFGRGG GESYQMVFQG DGFVVVQPYE EFGAGMLGGE       240
     SGGGLGRTMG DLFD                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page