(data stored in ACNUC30630 zone)

EMBL: AE000513.PE614

AE000513.PE614       Location/Qualifiers
FT   CDS             642869..643741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0628"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="similar to GB:M31827 SP:P18579 GB:X64259 PID:142833
FT                   PID:142849 percent identity: 54.71; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10206"
FT                   /db_xref="GOA:Q9RWN8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWN8"
FT                   /protein_id="AAF10206.1"
FT                   /translation="MSRSGARVERVPLARYTTLGVGGESEMWFVETHEQLAEAMSAPYR
FT                   ILGGGSNLVVSDSGVPERVLRLSGPLAERDLTPDPELSTPDLIVTGWVGGGVPLPGLIR
FT                   ALQKLGWSGLEGTVGIPGQVGGSVWMNAGTRFGEMFDGLHTIEIVTPDGVRQVTPDDLK
FT                   WGYRQSGIPRGHVVSRVRLKLRPSTPEAVLAKMEHADQARKGQPKNKTPGCAFKNPGGV
FT                   SAGKLIDEAGLKGTQVGNARIAPEHGNFIVNLGGATAADVHALLALIRERVGVPLELEY
FT                   ELWPEQLGG"
     MSRSGARVER VPLARYTTLG VGGESEMWFV ETHEQLAEAM SAPYRILGGG SNLVVSDSGV        60
     PERVLRLSGP LAERDLTPDP ELSTPDLIVT GWVGGGVPLP GLIRALQKLG WSGLEGTVGI       120
     PGQVGGSVWM NAGTRFGEMF DGLHTIEIVT PDGVRQVTPD DLKWGYRQSG IPRGHVVSRV       180
     RLKLRPSTPE AVLAKMEHAD QARKGQPKNK TPGCAFKNPG GVSAGKLIDE AGLKGTQVGN       240
     ARIAPEHGNF IVNLGGATAA DVHALLALIR ERVGVPLELE YELWPEQLGG                  290
//

If you have problems or comments...

PBIL Back to PBIL home page