(data stored in ACNUC30630 zone)

EMBL: AE000513.PE67

AE000513.PE67        Location/Qualifiers
FT   CDS             65110..65484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09661"
FT                   /db_xref="GOA:Q9RY82"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY82"
FT                   /protein_id="AAF09661.1"
FT                   /translation="MNFWRWLTTPDPHPGFTRPKLLKLAVRLFLFVLLATVLSSLLNLT
FT                   PLRPYLNTFWGSLLFVLLLYIPAARFLNIDTFMPRRFQTPPPQPGARAGQPATNTLDKR
FT                   REKNRYAGVRKSPPRMGGRR"
     MNFWRWLTTP DPHPGFTRPK LLKLAVRLFL FVLLATVLSS LLNLTPLRPY LNTFWGSLLF        60
     VLLLYIPAAR FLNIDTFMPR RFQTPPPQPG ARAGQPATNT LDKRREKNRY AGVRKSPPRM       120
     GGRR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page