(data stored in ACNUC30630 zone)

EMBL: AE000513.PE77

AE000513.PE77        Location/Qualifiers
FT   CDS             complement(79205..80125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0078"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /note="similar to GB:X65511 PID:39039 SP:P54894 percent
FT                   identity: 69.58; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09671"
FT                   /db_xref="GOA:Q9RY72"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY72"
FT                   /protein_id="AAF09671.1"
FT                   /translation="MNKPKIFIDGEAGTTGLQIRERLAGRSDLELLSIDPVRRKDSAAR
FT                   AELLNAADVSILCLHDDAAREAVSLTTNPASRLLDASTAHRIHPDWVFGFPELSAEQPE
FT                   KIRQARYVANPGCYSTGAIALLAPLTGRGLLPADFPVHIQGYSGYTGGGRALVDAHEQG
FT                   SAHPSKGAFISYGLTLEHKHLPETMVYGGLTRKPVFTPNVGGWAQGMTVTVPLHLAELG
FT                   VSAEALHAALKEHYAGQQYVKVFELADNPEILDPQTLNGTNNLELFVYPAADGERALLA
FT                   ARLDNLGKGASGAAVQNLELMLGLS"
     MNKPKIFIDG EAGTTGLQIR ERLAGRSDLE LLSIDPVRRK DSAARAELLN AADVSILCLH        60
     DDAAREAVSL TTNPASRLLD ASTAHRIHPD WVFGFPELSA EQPEKIRQAR YVANPGCYST       120
     GAIALLAPLT GRGLLPADFP VHIQGYSGYT GGGRALVDAH EQGSAHPSKG AFISYGLTLE       180
     HKHLPETMVY GGLTRKPVFT PNVGGWAQGM TVTVPLHLAE LGVSAEALHA ALKEHYAGQQ       240
     YVKVFELADN PEILDPQTLN GTNNLELFVY PAADGERALL AARLDNLGKG ASGAAVQNLE       300
     LMLGLS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page