(data stored in ACNUC30630 zone)

EMBL: AE000513.PE8

AE000513.PE8         Location/Qualifiers
FT   CDS             7819..8859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09603"
FT                   /db_xref="GOA:Q9RYE1"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE1"
FT                   /protein_id="AAF09603.1"
FT                   /translation="MSGGEAQGKRKQWQRWLSPRYVWRRLRHNIGPKLVSLGAALVLWS
FT                   VSTGDQRAQVQQSYDVPITVRDTTGASGSDERRAVSDLNPETVRVTLTGRPERLNELRP
FT                   SNIEALLDVTGVPEGSFNRPVQIVAPSNTVLSKQVPERVQGFVDSELSRTLTVTLGVAS
FT                   PAENSLPRFEVRPSEVQATAPSRVLNQVTRVVTSPVDLDPGEEREAPLIALDSRGRVVE
FT                   PVTLHPASVSVQRLDTGTLPVKTLPVVLGAPPASLRVQSQTLQPRTVRVVAAPELLGRL
FT                   REVSGQVDYRVGSSTLPVTLRLPDGAQALETVSVSLVVERIKAPDPGAGAPTQQKSGAS
FT                   SSSGGN"
     MSGGEAQGKR KQWQRWLSPR YVWRRLRHNI GPKLVSLGAA LVLWSVSTGD QRAQVQQSYD        60
     VPITVRDTTG ASGSDERRAV SDLNPETVRV TLTGRPERLN ELRPSNIEAL LDVTGVPEGS       120
     FNRPVQIVAP SNTVLSKQVP ERVQGFVDSE LSRTLTVTLG VASPAENSLP RFEVRPSEVQ       180
     ATAPSRVLNQ VTRVVTSPVD LDPGEEREAP LIALDSRGRV VEPVTLHPAS VSVQRLDTGT       240
     LPVKTLPVVL GAPPASLRVQ SQTLQPRTVR VVAAPELLGR LREVSGQVDY RVGSSTLPVT       300
     LRLPDGAQAL ETVSVSLVVE RIKAPDPGAG APTQQKSGAS SSSGGN                      346
//

If you have problems or comments...

PBIL Back to PBIL home page