(data stored in ACNUC30630 zone)

EMBL: AE000513.PE86

AE000513.PE86        Location/Qualifiers
FT   CDS             complement(88873..89346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:M15183 PID:468267 PID:2293279
FT                   GB:AL009126 percent identity: 66.00; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09680"
FT                   /db_xref="GOA:Q9RY63"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY63"
FT                   /protein_id="AAF09680.1"
FT                   /translation="MKCPYCSSPDSRVINSRPSDDGASIRRRRECLTCTRRFTTYERAQ
FT                   LEPLMVVKRSGVREAFNPDKLLRGLALASEKRPVEEAALRTFAYSFEDEVQGGEIPTEE
FT                   IGRRAMTFLRPLDDVAYIRFASVYRDFDSLERFIEEIRGLKGHEDEAPKSDPA"
     MKCPYCSSPD SRVINSRPSD DGASIRRRRE CLTCTRRFTT YERAQLEPLM VVKRSGVREA        60
     FNPDKLLRGL ALASEKRPVE EAALRTFAYS FEDEVQGGEI PTEEIGRRAM TFLRPLDDVA       120
     YIRFASVYRD FDSLERFIEE IRGLKGHEDE APKSDPA                                157
//

If you have problems or comments...

PBIL Back to PBIL home page