(data stored in ACNUC30630 zone)

EMBL: AE000513.PE89

AE000513.PE89        Location/Qualifiers
FT   CDS             complement(91257..91955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:577591 percent identity: 54.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09683"
FT                   /db_xref="GOA:Q9RY60"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY60"
FT                   /protein_id="AAF09683.1"
FT                   /translation="MPVEGDWTGPLVRLSIRRSLRAELAGVYVTGPLPPGGAVLAPNHQ
FT                   SWWDGYLLGELAWQCGADLRVMMTERQLGRFPFLRRVGAIGTGEVRAAVRHARRGGWTV
FT                   LFPEGALQPPGPLGALHPGAAWVARQAGVPLIPVGLRVLVRGAQKPEAFVRFAPPMPPA
FT                   DLAGALRAAVARLDADLHAADPDLPPAGYLRWVRGASSVHDRPGLPTRLLARLTTLQGA
FT                   SLPAPKGPLR"
     MPVEGDWTGP LVRLSIRRSL RAELAGVYVT GPLPPGGAVL APNHQSWWDG YLLGELAWQC        60
     GADLRVMMTE RQLGRFPFLR RVGAIGTGEV RAAVRHARRG GWTVLFPEGA LQPPGPLGAL       120
     HPGAAWVARQ AGVPLIPVGL RVLVRGAQKP EAFVRFAPPM PPADLAGALR AAVARLDADL       180
     HAADPDLPPA GYLRWVRGAS SVHDRPGLPT RLLARLTTLQ GASLPAPKGP LR               232
//

If you have problems or comments...

PBIL Back to PBIL home page