(data stored in ACNUC30630 zone)

EMBL: AE000513.PE9

AE000513.PE9         Location/Qualifiers
FT   CDS             8925..10283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 55.07;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09601"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE0"
FT                   /protein_id="AAF09601.1"
FT                   /translation="MTKFVSAPLICGLALLGALSAAHAQTGIPALPPIAQPLPVPAPAP
FT                   VTPPAPTVPVPQEPAPVPQPPMPQPSVPQTPAPQKPVTPRPAPAPSRAPLLIQARANVP
FT                   ALVAGKKTTVPVLKTLTIPAERAAQLRQRGEVSASLQADLDTFLKSLAAPRDARFEQQD
FT                   DGQWAVVQPNGLKVDAQATRAAVAKVLRDPRGVSANVVVTGQVAPQRTLDFFASRGITT
FT                   FLATGFTSYYGSSPERVKNIHVGAQNFKDRLFEGDVFSFNKFIGPVSERNGYVPGLVIA
FT                   GDQTASGVGGGICQVSTTVFRTLYGAGLGIVQRQNHSYQVFYYDPQGLDATIYQPQLDL
FT                   KFANTTGGPIWFQTEWDDQEATLTITAFGQARDYQVQVDAPKTLKTVAPPKDRLIPDAS
FT                   LPAGQRKQVDWAAPGATIEVTRRFTRGGKTFKQDTLRSVYRPWPNIFRVGTKK"
     MTKFVSAPLI CGLALLGALS AAHAQTGIPA LPPIAQPLPV PAPAPVTPPA PTVPVPQEPA        60
     PVPQPPMPQP SVPQTPAPQK PVTPRPAPAP SRAPLLIQAR ANVPALVAGK KTTVPVLKTL       120
     TIPAERAAQL RQRGEVSASL QADLDTFLKS LAAPRDARFE QQDDGQWAVV QPNGLKVDAQ       180
     ATRAAVAKVL RDPRGVSANV VVTGQVAPQR TLDFFASRGI TTFLATGFTS YYGSSPERVK       240
     NIHVGAQNFK DRLFEGDVFS FNKFIGPVSE RNGYVPGLVI AGDQTASGVG GGICQVSTTV       300
     FRTLYGAGLG IVQRQNHSYQ VFYYDPQGLD ATIYQPQLDL KFANTTGGPI WFQTEWDDQE       360
     ATLTITAFGQ ARDYQVQVDA PKTLKTVAPP KDRLIPDASL PAGQRKQVDW AAPGATIEVT       420
     RRFTRGGKTF KQDTLRSVYR PWPNIFRVGT KK                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page