(data stored in ACNUC30630 zone)

EMBL: AE000513.PE95

AE000513.PE95        Location/Qualifiers
FT   CDS             complement(97501..99252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0096"
FT                   /product="ABC transporter, ATP-binding protein, MsbA
FT                   family"
FT                   /note="similar to PID:1651679 percent identity: 61.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09688"
FT                   /db_xref="GOA:Q9RY54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY54"
FT                   /protein_id="AAF09688.1"
FT                   /translation="MAAPSPTLTVLRTYLGPLRGAVAALAALLLVGTGLNLLLPQLLSR
FT                   FVDAAKLGAQADVALLVRLAVTYLVLAVGVQLLSAGATYLGARVGWQATNRLRADLTAH
FT                   LLSLDMQEHKERTPGEMIERIDGDVTALSNFFSQFAVRVFGAALLLTGAVVMFWRTDWR
FT                   VGAGVTVFVALTLWAMNRVRKGGVEPTQQEREASAKLFGYVEERLAGLDDVRSLGAGEY
FT                   HLRGFLKVQREFFSRSIFSWRRRAVVWQLSMALFAVGYVALLASAVGLYAAGAITLGTA
FT                   FALYQYMTMVEEPIDQLTNQLQDLQKAGASVMRVGELLALRSHLPEGTRELPPGPLDLR
FT                   FDHVGFSYGGAEGTPVLRDVDLTLEAGQTLGLLGRTGSGKTTLTRLVSRLYDPTSGSVR
FT                   LGGVDTRDVTLASLRSRVAVVTQDVQLFQASVRDNLSFFDEGVSDAQVEAALAEVGLGD
FT                   WLSRLPEGVRTPLPAGSLSAGQAQLLAFARVMLRDPAVIILDEPSSRLDPATEAQLTAA
FT                   MTRLLAGRTAIVIAHRLDTVARADRIVVLGAGEVLEDGARTDLARDPRSHYAGLLRAGR
FT                   EAEAVLA"
     MAAPSPTLTV LRTYLGPLRG AVAALAALLL VGTGLNLLLP QLLSRFVDAA KLGAQADVAL        60
     LVRLAVTYLV LAVGVQLLSA GATYLGARVG WQATNRLRAD LTAHLLSLDM QEHKERTPGE       120
     MIERIDGDVT ALSNFFSQFA VRVFGAALLL TGAVVMFWRT DWRVGAGVTV FVALTLWAMN       180
     RVRKGGVEPT QQEREASAKL FGYVEERLAG LDDVRSLGAG EYHLRGFLKV QREFFSRSIF       240
     SWRRRAVVWQ LSMALFAVGY VALLASAVGL YAAGAITLGT AFALYQYMTM VEEPIDQLTN       300
     QLQDLQKAGA SVMRVGELLA LRSHLPEGTR ELPPGPLDLR FDHVGFSYGG AEGTPVLRDV       360
     DLTLEAGQTL GLLGRTGSGK TTLTRLVSRL YDPTSGSVRL GGVDTRDVTL ASLRSRVAVV       420
     TQDVQLFQAS VRDNLSFFDE GVSDAQVEAA LAEVGLGDWL SRLPEGVRTP LPAGSLSAGQ       480
     AQLLAFARVM LRDPAVIILD EPSSRLDPAT EAQLTAAMTR LLAGRTAIVI AHRLDTVARA       540
     DRIVVLGAGE VLEDGARTDL ARDPRSHYAG LLRAGREAEA VLA                         583
//

If you have problems or comments...

PBIL Back to PBIL home page