(data stored in ACNUC30630 zone)

EMBL: AE000513.PE99

AE000513.PE99        Location/Qualifiers
FT   CDS             101418..101696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0101"
FT                   /product="ribosomal protein S18"
FT                   /note="similar to SP:P10806 percent identity: 69.86;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09693"
FT                   /db_xref="GOA:Q9RY50"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY50"
FT                   /protein_id="AAF09693.1"
FT                   /translation="MTQQGNSGERKPRGKGPKRPRKPKVDPFSIGELEITDYKDVKMLR
FT                   RFVSDTGKILPRRRTGLSAKHQRRIAQTIKVARQLALLPYTEKLVRK"
     MTQQGNSGER KPRGKGPKRP RKPKVDPFSI GELEITDYKD VKMLRRFVSD TGKILPRRRT        60
     GLSAKHQRRI AQTIKVARQL ALLPYTEKLV RK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page