(data stored in ACNUC7421 zone)

EMBL: AE006468.AROL

AE006468.AROL        Location/Qualifiers
FT   CDS             440846..441391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="STM0388"
FT                   /product="shikimate kinase II"
FT                   /EC_number="2.7.1.71"
FT                   /note="similar to E. coli shikimate kinase II (AAC73491.1);
FT                   Blastp hit to AAC73491.1 (174 aa), 74% identity in aa 1 -
FT                   168"
FT                   /db_xref="EnsemblGenomes-Gn:STM0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19342"
FT                   /db_xref="GOA:P63603"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63603"
FT                   /protein_id="AAL19342.1"
FT                   /translation="MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSV
FT                   ADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCAPV
FT                   STLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKAPAQVVSE
FT                   IIAALPPSTQRLQGDVYT"
     MMQPLYLVGP RGCGKTTIGM ALAQATGFRF ADTDRWLQSH VQMSVADIVE KEGWGGFRAR        60
     ETAALEAVSA PSTVVATGGG IILTEYNRRY MHRVGVVIYL CAPVSTLVNR LEAEPEADLR       120
     PTLTGKPLSE EVREVLEQRD ALYRETAHYI IDATKAPAQV VSEIIAALPP STQRLQGDVY       180
     T                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page