(data stored in ACNUC7421 zone)

EMBL: AE006468.BCFA

AE006468.BCFA        Location/Qualifiers
FT   CDS             24469..25011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfA"
FT                   /locus_tag="STM0021"
FT                   /product="fimbrial subunit"
FT                   /note="fimbrial subunit (gi|4959511)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18985"
FT                   /db_xref="GOA:H9L412"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L412"
FT                   /protein_id="AAL18985.1"
FT                   /translation="MKKPVLALMVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAAC
FT                   SVSADSVDQTVTLGQVRASKLTEAGMVANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDA
FT                   NQPGSLANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGT
FT                   ATAGNVTATATFSMVYS"
     MKKPVLALMV SAIAFGGMLS TAQADTTTVT GGTVNFVGQV VDAACSVSAD SVDQTVTLGQ        60
     VRASKLTEAG MVANQKEDFT IKLEDCDTQT SQNAAVIFNG QQDANQPGSL ANTAGAGSAT       120
     NVALQLYGPD GQALNIGESS STVTLNDGEN VIPLSVDYIA TGTATAGNVT ATATFSMVYS       180
//

If you have problems or comments...

PBIL Back to PBIL home page