(data stored in ACNUC7421 zone)

EMBL: AE006468.BCFD

AE006468.BCFD        Location/Qualifiers
FT   CDS             28425..29432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfD"
FT                   /locus_tag="STM0024"
FT                   /product="fimbrial subunit"
FT                   /note="fimbrial subunit (gi|4959514)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18988"
FT                   /db_xref="GOA:Q8ZS05"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS05"
FT                   /protein_id="AAL18988.1"
FT                   /translation="MKIPLLFALLAGSVVSQYAFADVCKNVNGVPSSINYDLTTTLTAE
FT                   QNQVGKTVQLEKSQEVNVQAVCPAGASTYSQTYRSYVSPYPVVETSGNWKYLKLDPDYL
FT                   EGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTVNIS
FT                   PKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGNFNHA
FT                   GQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVVETDEG
FT                   NALIPNDVQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD"
     MKIPLLFALL AGSVVSQYAF ADVCKNVNGV PSSINYDLTT TLTAEQNQVG KTVQLEKSQE        60
     VNVQAVCPAG ASTYSQTYRS YVSPYPVVET SGNWKYLKLD PDYLEGGMRI EDSSAGDIYP       120
     PMNNVLMGYD ENVKAGQPFY VRDSNLEFQL KIVKPFVGTV NISPKTMFNV YVMTAAGDPL       180
     TDVVYSILYS GTVTVPQSCE INAGQTILVN FGALYSGNFN HAGQKPEGVR AKKFSVPVKC       240
     SGLDSQVNLT MRLIATPDSH VPQAIASDNA DVGVVVETDE GNALIPNDVQ SVAPFITDSA       300
     GRANITLQAY PVSTTGETPA EGAFTALASL RVDFD                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page