(data stored in ACNUC7421 zone)

EMBL: AE006468.CITD2

AE006468.CITD2       Location/Qualifiers
FT   CDS             69710..70003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD2"
FT                   /locus_tag="STM0059"
FT                   /product="putative citrate lyase acyl carrier protein,
FT                   gamma chain"
FT                   /note="similar to E. coli citrate lyase acyl carrier
FT                   protein (gamma chain) (AAC73718.1); Blastp hit to
FT                   AAC73718.1 (98 aa), 48% identity in aa 1 - 94"
FT                   /db_xref="EnsemblGenomes-Gn:STM0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19023"
FT                   /db_xref="GOA:Q7CR91"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR91"
FT                   /protein_id="AAL19023.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
     MKIIKDALAG TLESSDVMIR IGPSSEPGIR LELESLVKQQ FGAAIEQVVR ETLAKLGVER        60
     ALVSVDDKGA LECILRARVQ AAALRAAEQT EIQWSAL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page